PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G0355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 406aa    MW: 44212.8 Da    PI: 10.1147
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G0355genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95.3e-14328379556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L  + ee  ++ 
  Gh_A13G0355 328 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNEELLRKQEEVMEMQ 379
                  79************************************99988888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-12324390IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645326377IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.2E-13328378No hitNo description
SuperFamilySSF579595.13E-10328377No hitNo description
PfamPF001703.0E-12328380IPR004827Basic-leucine zipper domain
CDDcd147072.75E-25328382No hitNo description
PROSITE patternPS000360331346IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGSNLNFKRF GEAPSMEGSG SKAVGNFPLA RQSSIYSLTF DELQNTFGGL GKDFGSMNMD  60
ELLRNISTAE ETHGLMTASV PGGEGVSGGN LQRQGSLTLP RTLSQKTVEE VWKDLFKEND  120
GAKNVSNGGG GGGANLPQRQ QTLREMTLEE FLGRAGVVRE DMQPVGVPNN NGFFDNNSGL  180
ALQFQQRNGN NGFLSNNNSV LNQPPILPLD VSGAKSSHSQ QKQQPLFPKQ QTVAFAPSMH  240
LINTTHFPSP GARGSVVETS DLSMNTNLVQ SSGLQSGGMG IVGLPSPASH ISPDVISKNS  300
VDTTLSPVPY VLGRGRKRSA ALEKVVERRQ RRMIKNRESA ARSRARKQAY TLELEAEVAK  360
LKEMNEELLR KQEEVMEMQK NQMLETLNPA WGGKRQCLRR TLTGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.91640.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9643841e-104JX964384.1 Gossypium hirsutum clone NBRI_TRANS-653 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462275.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462274.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462273.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_012462272.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q31e-122AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A0B0NJ240.0A0A0B0NJ24_G
STRINGPOPTR_0009s10400.11e-159(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73427129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.15e-88abscisic acid responsive element-binding factor 1